General Information

  • ID:  hor004756
  • Uniprot ID:  Q9LNN7
  • Protein name:  GRIp
  • Gene name:  GRI
  • Organism:  Arabidopsis thaliana (Mouse-ear cress)
  • Family:  STIG1 family
  • Source:  Plant
  • Expression:  Highly expressed in flowers, and at very low levels in leaves.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Arabidopsis (genus), Camelineae (tribe), Brassicaceae (family), Brassicales (order), malvids, rosids, Pentapetalae, Gunneridae, eudicotyledons, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0006952 defense response; GO:0009863 salicylic acid mediated signaling pathway; GO:0009867 jasmonic acid mediated signaling pathway; GO:0010193 response to ozone; GO:0042742 defense response to bacterium; GO:0048316 seed development; GO:0080141 regulation of jasmonic acid biosynthetic process; GO:0080142 regulation of salicylic acid biosynthetic process
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0048046 apoplast

Sequence Information

  • Sequence:  LLVSHYKKIKK
  • Length:  11(68-78)
  • Propeptide:  MVIKIPNTFIKATSLLSLILYFLIIATSKSNSVLADEVVDQEDDPEYYILDETPSILSNVTISSKTRLLVSHYKKIKKGMRCHVESYNICNGVKANKGTSLLHCCKKHCRNVLGDRNNCGRCGHKCGFGQRCCGGVCTYVNFNPNHCGKCTRKCASGVKCEYGYCGYA
  • Signal peptide:  MVIKIPNTFIKATSLLSLILYFLIIATSKS
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Involved in the regulation of cell death induced by extracellular reactive oxygen species. The GRIp-induced cell death is superoxide and salicylic acid dependent.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9LNN7-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004756_AF2.pdbhor004756_ESM.pdb

Physical Information

Mass: 153527 Formula: C65H113N17O14
Absent amino acids: ACDEFGMNPQRTW Common amino acids: K
pI: 10.87 Basic residues: 5
Polar residues: 2 Hydrophobic residues: 4
Hydrophobicity: -41.82 Boman Index: -1160
Half-Life / Aliphatic Index: 5.5 hour Aliphatic Index: 132.73
Instability Index: 3360 Extinction Coefficient cystines: 1490
Absorbance 280nm: 149

Literature

  • PubMed ID:  19279211
  • Title:  Arabidopsis GRI is involved in the regulation of cell death induced by extracellular ROS.
  • PubMed ID:  25398910
  • Title:   GRIM REAPER peptide binds to receptor kinase PRK5 to trigger cell death in Arabidopsis.