HORDB

ID: hor004756
Uniprot ID: Q9LNN7(68-78)
Protein name: GRIp
Gene name: GRI
Organism: Arabidopsis thaliana (Mouse-ear cress)
Family: STIG1 family
Source: Plant
Expression: Highly expressed in flowers, and at very low levels in leaves.
Disease: NA
Comments: NA
Taxonomy: Arabidopsis (genus), Camelineae (tribe), Brassicaceae (family), Brassicales (order), malvids, rosids, Pentapetalae, Gunneridae, eudicotyledons, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
GO MF: NA
GO BP: GO:0006952 defense response; GO:0009863 salicylic acid mediated signaling pathway; GO:0009867 jasmonic acid mediated signaling pathway; GO:0010193 response to ozone; GO:0042742 defense response to bacterium; GO:0048316 seed development; GO:0080141 regulation of jasmonic acid biosynthetic process; GO:0080142 regulation of salicylic acid biosynthetic process
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0048046 apoplast

Sequence: LLVSHYKKIKK
Length: 11(68-78)
Propeptide: MVIKIPNTFIKATSLLSLILYFLIIATSKSNSVLADEVVDQEDDPEYYILDETPSILSNVTISSKTRLLVSHYKKIKKGMRCHVESYNICNGVKANKGTSLLHCCKKHCRNVLGDRNNCGRCGHKCGFGQRCCGGVCTYVNFNPNHCGKCTRKCASGVKCEYGYCGYA
Signal peptide: MVIKIPNTFIKATSLLSLILYFLIIATSKS
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: Involved in the regulation of cell death induced by extracellular reactive oxygen species. The GRIp-induced cell death is superoxide and salicylic acid dependent.
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor004756_AF2.pdb

hor004756_ESM.pdb

Mass:	153527	Formula:	C65H113N17O14
Absent amino acids:	ACDEFGMNPQRTW	Common amino acids:	K
pI:	10.87	Basic residues:	5
Polar residues:	2	Hydrophobic residues:	4
Hydrophobicity:	-41.82	Boman Index:	-1160
Half-Life:	5.5 hour	Half-Life Yeast:	3 min
Half-Life E.Coli:	2 min	Aliphatic Index	132.73
Instability Index:	3360	Extinction Coefficient cystines:	1490
Absorbance 280nm:	149

PubMed ID: 19279211
Title: Arabidopsis GRI is involved in the regulation of cell death induced by extracellular ROS.
PubMed ID: 25398910
Title: GRIM REAPER peptide binds to receptor kinase PRK5 to trigger cell death in Arabidopsis.